PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0755s0150.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 165aa    MW: 18191.5 Da    PI: 4.6306
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0755s0150.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM41.34.6e-131359148
                     NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                            lp+G+rF+P++++l+v+yLk+kv g++l++ ++i+++d+y + P++Lp
  SapurV1A.0755s0150.1.p 13 LPAGYRFSPNNDDLIVYYLKRKVLGQQLPA-DIIPTTDVYASSPNKLP 59
                            799***************************.99**************9 PP

2NAM27.39.9e-097511092128
                     NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             ++  +g++vg  ktL fykg++p+g++t+W+++e+r+
  SapurV1A.0755s0150.1.p  75 ITW-EGKTVGYVKTLNFYKGSSPDGKETEWMVEEFRV 110
                             555.7899***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.29E-246115IPR003441NAC domain
PROSITE profilePS5100512.95313158IPR003441NAC domain
PfamPF023657.0E-1214110IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MATGGQALNR PTLPAGYRFS PNNDDLIVYY LKRKVLGQQL PADIIPTTDV YASSPNKLPL  60
DGGYYAIDPE GAGPITWEGK TVGYVKTLNF YKGSSPDGKE TEWMVEEFRV NPEFVPVNND  120
DRSTQEKASV SGSTSRLTML YVVNVQIENL VACKISRVQP EPEW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-151211014140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2091842e-76AC209184.1 Populus trichocarpa clone POP031-J16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318469.12e-85hypothetical protein POPTR_0012s03130g
TrEMBLB9I2392e-85B9I239_POPTR; Uncharacterized protein
STRINGPOPTR_0012s03130.15e-85(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14452718
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33480.26e-18NAC domain containing protein 41